Strengths, codes, packs
| Per vial | Code | Pack | Status |
|---|---|---|---|
| 5 mg | LL375 | Box of 10 vials | Pre-order |
The vial is sealed and holds freeze-dried (lyophilised) powder.
We supply this strength to order, so a pre-order is the first step. Placing one commits you to nothing: the price and the delivery date are confirmed to you in writing first, and no payment is taken until then.
The record for this compound
| Entry | Value |
|---|---|
| Product name | LL-37 |
| Also known as | human cathelicidin LL-37 |
| Three-letter sequence | Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| One-letter sequence | [LL-37, 37 aa] |
| Residues | 37 |
| CAS registry number | 154947-66-7 |
| UniProt reference | P49913 |
| Formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Average molecular mass | 4493 g/mol |
| Monoisotopic mass | 4490.5754 Da |
Values in this table: PubChem CID 16198951. Where a batch certificate gives a different figure, the certificate governs. Our peptide calculator works out the mass from the sequence, so you can set it beside the certificate.
Papers with each batch
- A certificate of analysis, issued by the manufacturer for that batch. It records the batch number, an HPLC purity figure and a mass-spectrometry identity check.
- The same batch number, with its expiry date, in three places: printed on each vial, on its box and on our delivery note.
On request, where the manufacturer issues one: a safety data sheet.
Our guide to reading a certificate of analysis goes through one line by line.
Keeping it
Store it as the label directs. Do not break the seal until the day the vial is needed, and keep it dry and dark until then. Our guide to storing peptides gives the reasons, summer heat included.
Buying in Iraq
- Place a pre-order with the codes and quantities, attaching your company registration certificate (and the licence for your activity, where one is required). If you only need a price first, the quote form takes the same details.
- Sign our end-use declaration once, ahead of the first research-grade order.
- Our quotation comes back in US dollars and holds for 14 days; payment is by bank transfer.
- Delivery goes to the business address you name in Iraq, laboratory or office, with the batch certificate and our delivery note in the parcel.
We sell to companies and institutions, never to private persons, and we offer no advice on use. The full research line is listed on one page.
What buyers ask us
What is LL-37 sold for?
For laboratory research, which is what its label states. We do not describe any effect or use in people or animals. What research use only means
Which amino acids make up LL-37?
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser ([LL-37, 37 aa]), 37 residues in all.
What is the CAS registry number of LL-37?
CAS 154947-66-7, as entered in the record above.
Can a business in Iraq order LL-37?
Yes, as a pre-order. Companies and institutions in Baghdad, Basra, the other provinces and the Kurdistan Region can order it once we have checked their papers, and no payment is taken before we confirm.
How is LL-37 priced in Iraq?
Prices are quoted per order, in US dollars. List the codes and quantities on the quote form.
Can a private person buy LL-37?
No. We supply companies and institutions only. A buyer shows its company registration certificate, and it signs our end-use declaration ahead of its first research-grade order.